(data stored in ACNUC7421 zone)

EMBL: CP001389.PE134

CP001389.PE134       Location/Qualifiers
FT   CDS             148697..150187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01350"
FT                   /product="putative restriction endonuclease type I, S
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23938"
FT                   /db_xref="GOA:C3MFA1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA1"
FT                   /protein_id="ACP23938.1"
FT                   /translation="MSELPRGWCVTTIQEIADVGTGATPKRGTRAFYESGTIPWITSGA
FT                   VSQRQITYADEFITEAAIRSTNCKVFPTGTILVAMYGEGKTRGSVARLAIDAATNQALA
FT                   AIVLPNDDIVSSEFLMNFLTSQYSQLRGLAAGGVQPNLNLQLIRSTSFPLPPLAEQKRI
FT                   VAKLDALSAKSARARTELARIETLVYRYKQAVLGKAFSGELTVDFRLSRRHLQSEAKAG
FT                   SIHGEEGVERKLKVRGTTDVMKGIQLSPLPESWNWVKNHRLAQNRANAICAGPFGTIFK
FT                   AKDFRDKGIPIIFLRHVAAGEYRTHKPGFMDKKVWQELHQPYSVFGGELLVTKLGDPPG
FT                   VACIFPAGVGTAMVTPDVMKMSVDENASVPKFLMFYFNSPIAKNIIHQLAFGLTRLRVD
FT                   LAMFKTFPVPHPSLEEQLEIVRRIESAFAKIDRLAAEAKRALDLVGKLDEAILAKAFRG
FT                   ELVPQDENDEPAENLLERIRAERAAAPKAKRGRGNAKG"
     MSELPRGWCV TTIQEIADVG TGATPKRGTR AFYESGTIPW ITSGAVSQRQ ITYADEFITE        60
     AAIRSTNCKV FPTGTILVAM YGEGKTRGSV ARLAIDAATN QALAAIVLPN DDIVSSEFLM       120
     NFLTSQYSQL RGLAAGGVQP NLNLQLIRST SFPLPPLAEQ KRIVAKLDAL SAKSARARTE       180
     LARIETLVYR YKQAVLGKAF SGELTVDFRL SRRHLQSEAK AGSIHGEEGV ERKLKVRGTT       240
     DVMKGIQLSP LPESWNWVKN HRLAQNRANA ICAGPFGTIF KAKDFRDKGI PIIFLRHVAA       300
     GEYRTHKPGF MDKKVWQELH QPYSVFGGEL LVTKLGDPPG VACIFPAGVG TAMVTPDVMK       360
     MSVDENASVP KFLMFYFNSP IAKNIIHQLA FGLTRLRVDL AMFKTFPVPH PSLEEQLEIV       420
     RRIESAFAKI DRLAAEAKRA LDLVGKLDEA ILAKAFRGEL VPQDENDEPA ENLLERIRAE       480
     RAAAPKAKRG RGNAKG                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page