(data stored in ACNUC7421 zone)

EMBL: CP001389.PE135

CP001389.PE135       Location/Qualifiers
FT   CDS             150191..151438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23939"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA2"
FT                   /protein_id="ACP23939.1"
FT                   /translation="MSFLREGPITLIARLVRSEALTNDDLVLQKANRVAFEFDAIDARM
FT                   SADEALATIADRADRSRLAVLKILTTAEKFQYLADIGDVRDGQWYRINLLPRGKKPGPF
FT                   AWASSLGDAGYEEIVPFVLDEIRYLFSEVDSPLSPVGAAVGNERALAQAIAEACKFPER
FT                   AIGKSRAARNLLSGANSPHKIVVRDVGQASFCSAIDQHGNELFHLDAGWPISYNKKTAA
FT                   SKPRLKVSDVPVILSHWDWDHLHGYHAIAGLAGGIWIVPVQRLGPGAKLVAEKLATNNR
FT                   LLGVSSANVSAGPLRLGRCKGKAGNLNQTGLCVQTTLQSGKTVLFMGDADYDLVRPRLS
FT                   TLPDFIVATHHGAKFRGSVVSPRGGSGRCVVSVGKGNGYGHPSAAAVMCHSGAGWSMSF
FT                   TCERNGIPRGSRHLGP"
     MSFLREGPIT LIARLVRSEA LTNDDLVLQK ANRVAFEFDA IDARMSADEA LATIADRADR        60
     SRLAVLKILT TAEKFQYLAD IGDVRDGQWY RINLLPRGKK PGPFAWASSL GDAGYEEIVP       120
     FVLDEIRYLF SEVDSPLSPV GAAVGNERAL AQAIAEACKF PERAIGKSRA ARNLLSGANS       180
     PHKIVVRDVG QASFCSAIDQ HGNELFHLDA GWPISYNKKT AASKPRLKVS DVPVILSHWD       240
     WDHLHGYHAI AGLAGGIWIV PVQRLGPGAK LVAEKLATNN RLLGVSSANV SAGPLRLGRC       300
     KGKAGNLNQT GLCVQTTLQS GKTVLFMGDA DYDLVRPRLS TLPDFIVATH HGAKFRGSVV       360
     SPRGGSGRCV VSVGKGNGYG HPSAAAVMCH SGAGWSMSFT CERNGIPRGS RHLGP            415
//

If you have problems or comments...

PBIL Back to PBIL home page