(data stored in ACNUC7421 zone)

EMBL: CP001389.PE136

CP001389.PE136       Location/Qualifiers
FT   CDS             151961..154363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23940"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA3"
FT                   /protein_id="ACP23940.1"
FT                   /translation="MTPEEIFEDALVPNTRSVLVLGSFERRVTVYSQQVRALNLVDALL
FT                   SQNVVRDDGKIAIIGGGAAGVTAAVALSKAAPNLKALDLFEARADILQLQKNSTRYLHP
FT                   HFYDWPSIGSDEEDAGLPIMNWTAGPAGDVVRALWNQFDEACRTTRLSFYPNSTVTSLK
FT                   PSSISTVRVVTTGTAISRIYDVVILAIGFGLEAFLDGDTDSYWKPSALAGAMLVQMQEP
FT                   SIFISGNGDGGLVDFQMAAFNALDHRAICQLITNLDLGDALTELRTIEVEAWAPGANVN
FT                   LMDAYRMRVKPLIPAPAWATVVEALRNNVRIRLHTNEAQLLRKTTALHNRLATFLIIEA
FT                   DRDIERNAITVTTGVGFTDGVVPATGPISLDGEAPFTPYRRFLRLGPDSAPNLAPFDAL
FT                   LATYPGRLLPKASATRPESPTLTASARARFARFAPAAAPAQLPEQAAVGPRILRIVLQR
FT                   QGSNITWSGDLAPTDIDTLWRGNDGLSVYVDVAAADSDGLIAALARLGCHAASFHLYAR
FT                   DAQGWRTSMTSLCASRSLPGPDMGTRCIVNDWEDPPAVAQRATSPIADLTRIVSDRLDL
FT                   ETLSQLHGALYDVLGPPNVEIGWLIEARLKGQLWARWLNWHPVLQAESATRRRFMLLLV
FT                   TEQDHDNITPELLVRVGPRSLRPFLTKPTIFGLTFAVCSEHAVSPIAVAPGNMAGGGLT
FT                   GHACGVGWIQGRDLSAGFAAAQAWTTGVVLLAQLREAFRLAERDVRFDHAPGDQAKVGD
FT                   VLLDQEPLVIPADELFVIALEAGEQSMQQHLRSVIQWRATTNRASLE"
     MTPEEIFEDA LVPNTRSVLV LGSFERRVTV YSQQVRALNL VDALLSQNVV RDDGKIAIIG        60
     GGAAGVTAAV ALSKAAPNLK ALDLFEARAD ILQLQKNSTR YLHPHFYDWP SIGSDEEDAG       120
     LPIMNWTAGP AGDVVRALWN QFDEACRTTR LSFYPNSTVT SLKPSSISTV RVVTTGTAIS       180
     RIYDVVILAI GFGLEAFLDG DTDSYWKPSA LAGAMLVQMQ EPSIFISGNG DGGLVDFQMA       240
     AFNALDHRAI CQLITNLDLG DALTELRTIE VEAWAPGANV NLMDAYRMRV KPLIPAPAWA       300
     TVVEALRNNV RIRLHTNEAQ LLRKTTALHN RLATFLIIEA DRDIERNAIT VTTGVGFTDG       360
     VVPATGPISL DGEAPFTPYR RFLRLGPDSA PNLAPFDALL ATYPGRLLPK ASATRPESPT       420
     LTASARARFA RFAPAAAPAQ LPEQAAVGPR ILRIVLQRQG SNITWSGDLA PTDIDTLWRG       480
     NDGLSVYVDV AAADSDGLIA ALARLGCHAA SFHLYARDAQ GWRTSMTSLC ASRSLPGPDM       540
     GTRCIVNDWE DPPAVAQRAT SPIADLTRIV SDRLDLETLS QLHGALYDVL GPPNVEIGWL       600
     IEARLKGQLW ARWLNWHPVL QAESATRRRF MLLLVTEQDH DNITPELLVR VGPRSLRPFL       660
     TKPTIFGLTF AVCSEHAVSP IAVAPGNMAG GGLTGHACGV GWIQGRDLSA GFAAAQAWTT       720
     GVVLLAQLRE AFRLAERDVR FDHAPGDQAK VGDVLLDQEP LVIPADELFV IALEAGEQSM       780
     QQHLRSVIQW RATTNRASLE                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page