(data stored in ACNUC7421 zone)

EMBL: CP001389.PE137

CP001389.PE137       Location/Qualifiers
FT   CDS             155006..158062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA4"
FT                   /protein_id="ACP23941.1"
FT                   /translation="MSEIFLRSVELSNFRVYGDSYVFELPAEPGVTLITGANGLGKTSF
FT                   FDGVEWALTGQVGRFSDIRTDSRRREADPLTRLGAPENSHRVALAFTDGEPIDRGCGFL
FT                   PTEHEVAALLKQERWPAISNLHGYLSITHFLGQASTRRFSLREPKAQWEALKGPAGVDR
FT                   INSLRERVSGQGARQAFTRAIRDRTLRLEKASEALQSWLSLIEERDRLARLSSSERSFP
FT                   PQQVLEECERILAQLAPLLPAAQHEIAGRTEEPEAVLQRLGSLIGEVDEYNRAEEAKLK
FT                   ALEAIVAAYERSIAETAAKSALVKEMGARRSQLVDDLARAEATLNHAATAHGRSRQLSA
FT                   QLMARSATLARVEAAVAQLQSASSAIAETERQLDLSKAEEGRAQRRRGDVQSEMDNAKA
FT                   LRTERSRASTQLSQAQKRAQISTALSQTRSEIARLTSLTSARDSEQLTARRSEIVNAQS
FT                   LVKVEIDRLTTELRRHDERGRLLAEAIASIAHQLSHEDETCPICDSHFPPGRLKELADA
FT                   QARAGTAPASVLAANLSHARSEQEALMRRQSEVDRALTELGQLSASLVVLQEQEAHLLQ
FT                   ALVEAGGAVDVHYDGSGIDAARMVLASLDERIENGPSEVALDSLLAEVQAAMDAERARQ
FT                   GNLDRLRLNAISDAEAARSFLSQHPDLWAPDHGLLISLGEQLTAIRAESALIGEKVQND
FT                   QTNVEAARLRRDAIMEAIATEDASLSTSNRELDREAELRRDLLRQWNDAGQTGDPDSAR
FT                   VAQVSSRVAERSIRIGPIALAHAELIDSLRVWRNDQQLQDRERSIAATLANFGLSTIPQ
FT                   VTERFTRDIAVIQDELDLAQKARARMDDVGQKMQQRAEEFADEVLKPLNDTIQRFALPL
FT                   MTWTDASIIYRAEHHATRSELKPAIVRTDSDGKVTQLEMNPNLFFSEGQLSALSVSALL
FT                   AASTTFSWSRWRGLLLDDPLQHNDVIHASAFMDLIRQMVRELGYQVVLSTHDSTEAEFL
FT                   VRKCKSAGIPFAIHELVPRGEEGLISEVA"
     MSEIFLRSVE LSNFRVYGDS YVFELPAEPG VTLITGANGL GKTSFFDGVE WALTGQVGRF        60
     SDIRTDSRRR EADPLTRLGA PENSHRVALA FTDGEPIDRG CGFLPTEHEV AALLKQERWP       120
     AISNLHGYLS ITHFLGQAST RRFSLREPKA QWEALKGPAG VDRINSLRER VSGQGARQAF       180
     TRAIRDRTLR LEKASEALQS WLSLIEERDR LARLSSSERS FPPQQVLEEC ERILAQLAPL       240
     LPAAQHEIAG RTEEPEAVLQ RLGSLIGEVD EYNRAEEAKL KALEAIVAAY ERSIAETAAK       300
     SALVKEMGAR RSQLVDDLAR AEATLNHAAT AHGRSRQLSA QLMARSATLA RVEAAVAQLQ       360
     SASSAIAETE RQLDLSKAEE GRAQRRRGDV QSEMDNAKAL RTERSRASTQ LSQAQKRAQI       420
     STALSQTRSE IARLTSLTSA RDSEQLTARR SEIVNAQSLV KVEIDRLTTE LRRHDERGRL       480
     LAEAIASIAH QLSHEDETCP ICDSHFPPGR LKELADAQAR AGTAPASVLA ANLSHARSEQ       540
     EALMRRQSEV DRALTELGQL SASLVVLQEQ EAHLLQALVE AGGAVDVHYD GSGIDAARMV       600
     LASLDERIEN GPSEVALDSL LAEVQAAMDA ERARQGNLDR LRLNAISDAE AARSFLSQHP       660
     DLWAPDHGLL ISLGEQLTAI RAESALIGEK VQNDQTNVEA ARLRRDAIME AIATEDASLS       720
     TSNRELDREA ELRRDLLRQW NDAGQTGDPD SARVAQVSSR VAERSIRIGP IALAHAELID       780
     SLRVWRNDQQ LQDRERSIAA TLANFGLSTI PQVTERFTRD IAVIQDELDL AQKARARMDD       840
     VGQKMQQRAE EFADEVLKPL NDTIQRFALP LMTWTDASII YRAEHHATRS ELKPAIVRTD       900
     SDGKVTQLEM NPNLFFSEGQ LSALSVSALL AASTTFSWSR WRGLLLDDPL QHNDVIHASA       960
     FMDLIRQMVR ELGYQVVLST HDSTEAEFLV RKCKSAGIPF AIHELVPRGE EGLISEVA        1018
//

If you have problems or comments...

PBIL Back to PBIL home page