(data stored in ACNUC7421 zone)

EMBL: CP001389.PE139

CP001389.PE139       Location/Qualifiers
FT   CDS             159776..160948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01410"
FT                   /product="possible BirS-like protein incolved in biotin
FT                   regulatory network"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23943"
FT                   /db_xref="GOA:C3MFA6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA6"
FT                   /protein_id="ACP23943.1"
FT                   /translation="MSGLETAIRNALERSERSNAEVRARIYQSARQALENGLKKQEIED
FT                   PDIIAKQRHRLEAVIHAIETEERAALKARVASPVVSLAEVKAKGDAAGSAPAGAAAAAR
FT                   QEPGFQAEARAASTADGGLGALGALRPERDGPMAAAQPVTDGEKTVGAARSGSIAPDLG
FT                   VADKRPRKRRRGRLLSFFMVVATLAAAVGAGVWWVETNDLLKSPAERDTNVANPPAVVE
FT                   SEDFPGAAGLPTLGAQEGFSGDWIEVFTSADVSAVKPGTRASAEPFDDDGGERIRLTSA
FT                   AGAKEGEVAIDIPADVLAKLSGKSSTLALSVQALPGKTTEFSVECDFAALGACGRHRFT
FT                   AHDERVDMLFKMSFEDGRAPGSSGRLLINSDVSGAGNSLDLFAIRVLPGQ"
     MSGLETAIRN ALERSERSNA EVRARIYQSA RQALENGLKK QEIEDPDIIA KQRHRLEAVI        60
     HAIETEERAA LKARVASPVV SLAEVKAKGD AAGSAPAGAA AAARQEPGFQ AEARAASTAD       120
     GGLGALGALR PERDGPMAAA QPVTDGEKTV GAARSGSIAP DLGVADKRPR KRRRGRLLSF       180
     FMVVATLAAA VGAGVWWVET NDLLKSPAER DTNVANPPAV VESEDFPGAA GLPTLGAQEG       240
     FSGDWIEVFT SADVSAVKPG TRASAEPFDD DGGERIRLTS AAGAKEGEVA IDIPADVLAK       300
     LSGKSSTLAL SVQALPGKTT EFSVECDFAA LGACGRHRFT AHDERVDMLF KMSFEDGRAP       360
     GSSGRLLINS DVSGAGNSLD LFAIRVLPGQ                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page