(data stored in ACNUC7421 zone)

EMBL: CP001389.PE142

CP001389.PE142       Location/Qualifiers
FT   CDS             163793..164827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01440"
FT                   /product="predicted phosphate ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23946"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA9"
FT                   /protein_id="ACP23946.1"
FT                   /translation="MKVLKLTVAALVASAAFAGAAVARDQIQVAGSSTVLPYAKIVAET
FT                   FGETFPDFKTPVVESGGSSAGLKEFCKGVGEDTIDIANSSRKIKDSEVEACKAAGVTEI
FT                   QEVKIGYDGIVFATDAGNADLALKPEQLYKALAAEVVVDGKLVANPYKKWSEIDASLPD
FT                   AEIAAYIPGEKHGTREVFEEKILAHGCKDAGAVDVIKAAISDEKAAAKKCVAVRKDGLA
FT                   VDIDGDYTETLARIASNKSGIGVFGLSFYENNADKLKVATVSGIVPSTETIASGEYPVS
FT                   RPLFFYVKKAHLGVVPGLKEYVEFFVDDQMIGPDGPLAEYGLVAAPDAEREEIRKTFEA
FT                   GNLL"
     MKVLKLTVAA LVASAAFAGA AVARDQIQVA GSSTVLPYAK IVAETFGETF PDFKTPVVES        60
     GGSSAGLKEF CKGVGEDTID IANSSRKIKD SEVEACKAAG VTEIQEVKIG YDGIVFATDA       120
     GNADLALKPE QLYKALAAEV VVDGKLVANP YKKWSEIDAS LPDAEIAAYI PGEKHGTREV       180
     FEEKILAHGC KDAGAVDVIK AAISDEKAAA KKCVAVRKDG LAVDIDGDYT ETLARIASNK       240
     SGIGVFGLSF YENNADKLKV ATVSGIVPST ETIASGEYPV SRPLFFYVKK AHLGVVPGLK       300
     EYVEFFVDDQ MIGPDGPLAE YGLVAAPDAE REEIRKTFEA GNLL                        344
//

If you have problems or comments...

PBIL Back to PBIL home page