(data stored in ACNUC7421 zone)

EMBL: CP001389.PE143

CP001389.PE143       Location/Qualifiers
FT   CDS             164922..166406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01450"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23947"
FT                   /db_xref="GOA:C3MFB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB0"
FT                   /protein_id="ACP23947.1"
FT                   /translation="MSTTLLLLTILLIGLVAYFAGRARSLALSGSKLATLHSLPGYHGS
FT                   YVAIWAVLPAALVLAAWLLASPLYIDSSVRSALPETVQNQGAATVQLALSQVKAVATGL
FT                   GRLDATEIEAVKTGSANLRETLAAKGVALAGEGEPFMVEAAEQFNAMRGHSRWLMSAVV
FT                   LLVAVAGGLYAIRNVTTRFRARNQVERVMLGSLVVASSIAILTTIGIIGSMLSEAGRFF
FT                   SMVSPAEFFFGTVWDPRFAAAGSEGSSGQFGLLPLLGGTLYIAFVAMAFAVPIGLFAAI
FT                   YMAEYASPRLRSIAKPLLEVLAGIPTIVYGFFALVTVGPFLRDISTQLNGLLTGNYQNF
FT                   IQAQSVLTAGIVMGIMLIPFVSSLSDDIITQVPRALRDGSLGLGATRSETVKRVILPAA
FT                   LPGIVGALLLTASRAVGETMIVVLAAGVAARMQINPFEPMTTVTVKIVHQLTGDLEFTS
FT                   PQTLVAFALGITLFVITLGLNIYALYIVRKYREQYE"
     MSTTLLLLTI LLIGLVAYFA GRARSLALSG SKLATLHSLP GYHGSYVAIW AVLPAALVLA        60
     AWLLASPLYI DSSVRSALPE TVQNQGAATV QLALSQVKAV ATGLGRLDAT EIEAVKTGSA       120
     NLRETLAAKG VALAGEGEPF MVEAAEQFNA MRGHSRWLMS AVVLLVAVAG GLYAIRNVTT       180
     RFRARNQVER VMLGSLVVAS SIAILTTIGI IGSMLSEAGR FFSMVSPAEF FFGTVWDPRF       240
     AAAGSEGSSG QFGLLPLLGG TLYIAFVAMA FAVPIGLFAA IYMAEYASPR LRSIAKPLLE       300
     VLAGIPTIVY GFFALVTVGP FLRDISTQLN GLLTGNYQNF IQAQSVLTAG IVMGIMLIPF       360
     VSSLSDDIIT QVPRALRDGS LGLGATRSET VKRVILPAAL PGIVGALLLT ASRAVGETMI       420
     VVLAAGVAAR MQINPFEPMT TVTVKIVHQL TGDLEFTSPQ TLVAFALGIT LFVITLGLNI       480
     YALYIVRKYR EQYE                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page