(data stored in ACNUC7421 zone)

EMBL: CP001389.PE144

CP001389.PE144       Location/Qualifiers
FT   CDS             166403..167725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01460"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23948"
FT                   /db_xref="GOA:C3MFB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB1"
FT                   /protein_id="ACP23948.1"
FT                   /translation="MTDVASPMVRVSTRPAESRRDIGIKRRYAAERRFRAYGISAIAIG
FT                   LFFLAVLLWSVASKGYTAFQQTTITLPIEFSEKVIDPKNERATDPKQLMTANYPVLVRD
FT                   ALVKQLGIDPKKRPLVKQATDMVSDSVRTQLRDIVTGDPSVIGKTIPVTLLADANIDSA
FT                   FKGQIDLSVEESKRKVKDQQVTWMNELAEAGVLKKSFNTGIFSFGASSRPEAAGVGVAL
FT                   VGSAYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLA
FT                   VFVNFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPPSIRSAALGLGASKMQTIF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDYPGSPLEPSTALPVQIYMW
FT                   ANEAERAFVERTSGAIIILLIFLIIMNLGAILLRRRFERRW"
     MTDVASPMVR VSTRPAESRR DIGIKRRYAA ERRFRAYGIS AIAIGLFFLA VLLWSVASKG        60
     YTAFQQTTIT LPIEFSEKVI DPKNERATDP KQLMTANYPV LVRDALVKQL GIDPKKRPLV       120
     KQATDMVSDS VRTQLRDIVT GDPSVIGKTI PVTLLADANI DSAFKGQIDL SVEESKRKVK       180
     DQQVTWMNEL AEAGVLKKSF NTGIFSFGAS SRPEAAGVGV ALVGSAYMML IVLVLSLPIG       240
     VAASIYLEEF APKNRLTDLI EVNINNLAAV PSIVYGLLGL AVFVNFAGMP RSAALVGGFV       300
     LTLMTLPTII IATRAALKAV PPSIRSAALG LGASKMQTIF HHVLPLAMPG ILTGTIIGLA       360
     HALGETAPLL LIGMVAFVVD YPGSPLEPST ALPVQIYMWA NEAERAFVER TSGAIIILLI       420
     FLIIMNLGAI LLRRRFERRW                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page