(data stored in ACNUC7421 zone)

EMBL: CP001389.PE145

CP001389.PE145       Location/Qualifiers
FT   CDS             167738..168553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01470"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23949"
FT                   /db_xref="GOA:C3MFB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB2"
FT                   /protein_id="ACP23949.1"
FT                   /translation="MNIMSEAAVEKALDQKMNTVPLKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRTLNRMNDTIENCRVTGRITLDEDDIYDPSIDVVELRA
FT                   RVGMVFQKPNPFPKSIYENVSYGPRIHGLARTKADFDEIVETSLQKAGLWNEVKDRLQE
FT                   PGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRANFTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDQRTQDYIMGRFG"
     MNIMSEAAVE KALDQKMNTV PLKMIGKDVS VYYGEKRALF DVNLNIRENT VTALIGPSGC        60
     GKSTFLRTLN RMNDTIENCR VTGRITLDED DIYDPSIDVV ELRARVGMVF QKPNPFPKSI       120
     YENVSYGPRI HGLARTKADF DEIVETSLQK AGLWNEVKDR LQEPGTGLSG GQQQRLCIAR       180
     AVAVSPEVIL MDEPCSALDP IATAKVEELI HELRANFTIV IVTHSMQQAA RVSQRTAMFH       240
     LGNLVEENDT DKMFTNPDDQ RTQDYIMGRF G                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page