(data stored in ACNUC7421 zone)

EMBL: CP001389.PE148

CP001389.PE148       Location/Qualifiers
FT   CDS             complement(170132..170650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23952"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB5"
FT                   /protein_id="ACP23952.1"
FT                   /translation="MNWTDERVEKLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLSL
FT                   PGRAKAGGTTAAARPKRATSAPRAPNYAARAVTRTVTRTAGATVLKEEVAVDLVAEQDL
FT                   VLDTNIVVPMSRRLELTQLTERTCKWPIGDPLKEEFHFCGNDSPESSPYCSYHARLAYQ
FT                   PSAERRRMR"
     MNWTDERVEK LKKLWSEGLS ASQIAAQLGG VSRNAVIGKV HRLSLPGRAK AGGTTAAARP        60
     KRATSAPRAP NYAARAVTRT VTRTAGATVL KEEVAVDLVA EQDLVLDTNI VVPMSRRLEL       120
     TQLTERTCKW PIGDPLKEEF HFCGNDSPES SPYCSYHARL AYQPSAERRR MR               172
//

If you have problems or comments...

PBIL Back to PBIL home page