(data stored in ACNUC7421 zone)

EMBL: CP001389.PE156

CP001389.PE156       Location/Qualifiers
FT   CDS             178722..179573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01600"
FT                   /product="predicted extracellular amino acid solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC3"
FT                   /protein_id="ACP23960.1"
FT                   /translation="MTRVFFHRLFGMLAVTVALLASGAGAAPNDLPLLFDARERIAKPD
FT                   LTALARLRFLTTVDFPPFNFIDQSGKLSGFHVDLAREICRELEIESKCQIQAVTYPELM
FT                   PALEQGQGEAIVAGIAVTPELRRRFAFSRAFMQMPARFALNRKAAEGVKSPADLVGKPI
FT                   GAVAGTTHEAMLKAFFPQLEAKAYPDRDALLNALREGAVTAAFSDAMQLSFWVSGSVAA
FT                   GCCTLLDGAYFSERFLGEGLTIMNRTTEPALTQAIDHALLALSRSGRLEEIYLRYFPNG
FT                   IY"
     MTRVFFHRLF GMLAVTVALL ASGAGAAPND LPLLFDARER IAKPDLTALA RLRFLTTVDF        60
     PPFNFIDQSG KLSGFHVDLA REICRELEIE SKCQIQAVTY PELMPALEQG QGEAIVAGIA       120
     VTPELRRRFA FSRAFMQMPA RFALNRKAAE GVKSPADLVG KPIGAVAGTT HEAMLKAFFP       180
     QLEAKAYPDR DALLNALREG AVTAAFSDAM QLSFWVSGSV AAGCCTLLDG AYFSERFLGE       240
     GLTIMNRTTE PALTQAIDHA LLALSRSGRL EEIYLRYFPN GIY                         283
//

If you have problems or comments...

PBIL Back to PBIL home page