(data stored in ACNUC7421 zone)

EMBL: CP001389.PE157

CP001389.PE157       Location/Qualifiers
FT   CDS             complement(179598..180008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23961"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC4"
FT                   /protein_id="ACP23961.1"
FT                   /translation="MSASFSQHEALVYVMVMMSAVDRSMSDDEFARIGGLVRFLPAFDG
FT                   FDEDRLVHIGRECAAQLAAPEGLDVTLEMVRESLPQRHYETAYALAVEIAAADQRIRTE
FT                   EIRLLQLLRDRLALDKLTCAAIERGALARFRR"
     MSASFSQHEA LVYVMVMMSA VDRSMSDDEF ARIGGLVRFL PAFDGFDEDR LVHIGRECAA        60
     QLAAPEGLDV TLEMVRESLP QRHYETAYAL AVEIAAADQR IRTEEIRLLQ LLRDRLALDK       120
     LTCAAIERGA LARFRR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page