(data stored in ACNUC7421 zone)

EMBL: CP001389.PE158

CP001389.PE158       Location/Qualifiers
FT   CDS             complement(180057..180866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23962"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC5"
FT                   /protein_id="ACP23962.1"
FT                   /translation="MRPQVISIVGGLAALALYAAILLGGAATIRGRESAATPDFVLETP
FT                   DAAAIDEPAEEPVPAAEPPAEPAPPPAEAAAKTSRTPVRPVDPNLFAIPEEGVAKPLER
FT                   IAPRPPFSAPPEKKAVPLVLQRPVALAAGLVQNGDTTLQIKDIEPEKAEKVCEGAGKSW
FT                   PCGMVARTAFRNFLRGRALVCDQIDEKAEGSPAVSCKVGNMNVAEWLVTNGWATPLPGT
FT                   PLEAKAEDARNAKRGFYGDDPRDLRRRPAVIEEPAAGTDFGEPAPDL"
     MRPQVISIVG GLAALALYAA ILLGGAATIR GRESAATPDF VLETPDAAAI DEPAEEPVPA        60
     AEPPAEPAPP PAEAAAKTSR TPVRPVDPNL FAIPEEGVAK PLERIAPRPP FSAPPEKKAV       120
     PLVLQRPVAL AAGLVQNGDT TLQIKDIEPE KAEKVCEGAG KSWPCGMVAR TAFRNFLRGR       180
     ALVCDQIDEK AEGSPAVSCK VGNMNVAEWL VTNGWATPLP GTPLEAKAED ARNAKRGFYG       240
     DDPRDLRRRP AVIEEPAAGT DFGEPAPDL                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page