(data stored in ACNUC7421 zone)

EMBL: CP001389.PE16

CP001389.PE16        Location/Qualifiers
FT   CDS             complement(14101..14673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00160"
FT                   /product="ribosomal protein S30Ae/sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23820"
FT                   /db_xref="GOA:C3MEJ7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ7"
FT                   /protein_id="ACP23820.1"
FT                   /translation="MSVRVSGKHMEIGESFRSRIGEQIREAVAKYFDGGYSSQVTVEKS
FT                   GSRFSADCKLHLDTGVVLQANGQANEPQAAFDAASDRIEKRLRRYKRKLKDHHNGNGQN
FT                   AAEVAYRVMDSVPFEDEEVPDDYAPTIVAESTKQLRTMSVANAVMALDMTDEPVLMFRS
FT                   PGKDDLNIVYRRNDGNIGWIDAANIKG"
     MSVRVSGKHM EIGESFRSRI GEQIREAVAK YFDGGYSSQV TVEKSGSRFS ADCKLHLDTG        60
     VVLQANGQAN EPQAAFDAAS DRIEKRLRRY KRKLKDHHNG NGQNAAEVAY RVMDSVPFED       120
     EEVPDDYAPT IVAESTKQLR TMSVANAVMA LDMTDEPVLM FRSPGKDDLN IVYRRNDGNI       180
     GWIDAANIKG                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page