(data stored in ACNUC7421 zone)

EMBL: CP001389.PE160

CP001389.PE160       Location/Qualifiers
FT   CDS             complement(181691..182215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01640"
FT                   /product="putative transcriptional regulator protein, HxlR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23964"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC7"
FT                   /protein_id="ACP23964.1"
FT                   /translation="MTDDHRSACPINLSLEVFGDKWSLLIIRDMIFGGKRHFRELLRSQ
FT                   EGISSNILADRLKTLLEIGMLTKRDDPSHKQKAIYSLTEMAIALVPIMAHLGAWGRRYL
FT                   PVSEELSIRAQLMEEGGPVLWERFMDELRAEHLGVSRVSEGPSVRQTLQAAYEEVIARK
FT                   ATEREPANAGS"
     MTDDHRSACP INLSLEVFGD KWSLLIIRDM IFGGKRHFRE LLRSQEGISS NILADRLKTL        60
     LEIGMLTKRD DPSHKQKAIY SLTEMAIALV PIMAHLGAWG RRYLPVSEEL SIRAQLMEEG       120
     GPVLWERFMD ELRAEHLGVS RVSEGPSVRQ TLQAAYEEVI ARKATEREPA NAGS             174
//

If you have problems or comments...

PBIL Back to PBIL home page