(data stored in ACNUC7421 zone)

EMBL: CP001389.PE161

CP001389.PE161       Location/Qualifiers
FT   CDS             complement(182367..182945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01650"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23965"
FT                   /db_xref="GOA:C3MFC8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC8"
FT                   /protein_id="ACP23965.1"
FT                   /translation="MQPLPFALAILLLLATPGPTNTLLWLSGAAAGMRRSLPLLAGELG
FT                   GYLTVIVPVTVLAAPLISAHPAVGLLLKLAAAGWILFMAHALWTMKAQGASDRPIAPGQ
FT                   VFVTTLLNPKALIIALVIMPQVGLQAMLPWLLGFAMLTLGAGSLWIAAGTLLARLPRPV
FT                   APRLPRRIAAVCLVAFSFGIAGSALASMI"
     MQPLPFALAI LLLLATPGPT NTLLWLSGAA AGMRRSLPLL AGELGGYLTV IVPVTVLAAP        60
     LISAHPAVGL LLKLAAAGWI LFMAHALWTM KAQGASDRPI APGQVFVTTL LNPKALIIAL       120
     VIMPQVGLQA MLPWLLGFAM LTLGAGSLWI AAGTLLARLP RPVAPRLPRR IAAVCLVAFS       180
     FGIAGSALAS MI                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page