(data stored in ACNUC7421 zone)

EMBL: CP001389.PE162

CP001389.PE162       Location/Qualifiers
FT   CDS             complement(183275..183637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23966"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC9"
FT                   /protein_id="ACP23966.1"
FT                   /translation="MPTRCRFPPRSTVLGMRTGGTTMSKSNRITVENIIHPGKTTSVDA
FT                   DKYAAMKTALLAVIPVQAPGLTLAEVRERIFAHLPEERFPGGKGVSWWSKAVQLDLEAR
FT                   GEIVREKTRPIRLHRS"
     MPTRCRFPPR STVLGMRTGG TTMSKSNRIT VENIIHPGKT TSVDADKYAA MKTALLAVIP        60
     VQAPGLTLAE VRERIFAHLP EERFPGGKGV SWWSKAVQLD LEARGEIVRE KTRPIRLHRS       120
//

If you have problems or comments...

PBIL Back to PBIL home page