(data stored in ACNUC7421 zone)

EMBL: CP001389.PE165

CP001389.PE165       Location/Qualifiers
FT   CDS             complement(187532..189328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01690"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23969"
FT                   /db_xref="GOA:C3MFR8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR8"
FT                   /protein_id="ACP23969.1"
FT                   /translation="MPIYKAPVDDTLFILNDVLGLERYHNLPGFADATPDMVAAILGEA
FT                   ARLAEEELFPINLSGDQEGCKRNDDGSVTTPAGFKQAFDLYREGGWLGLAAPEEFGGQG
FT                   LPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMVDGTWTGTM
FT                   NLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAGEHDMAENIIHLVLARIEGAPE
FT                   GVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIHGNSTCVMNYDEATGYLIGAE
FT                   NKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGVKAPEQKADPI
FT                   IVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGLMTPILKG
FT                   VLTDKGFDHTVVAQQLFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAI
FT                   NGGRAVMALFKEIGDFCEENRGDERLSAYTKALKKGLNDLQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKIAKTAHDKLAAGETAQADYLKNKLITANFFMERILPET
FT                   ALRKARIETGADTLMALDAAAF"
     MPIYKAPVDD TLFILNDVLG LERYHNLPGF ADATPDMVAA ILGEAARLAE EELFPINLSG        60
     DQEGCKRNDD GSVTTPAGFK QAFDLYREGG WLGLAAPEEF GGQGLPYTLH TAVGEFLSAA       120
     NMSLMMYPGL TQGAIAAILV HGSEEQKRAY LPKMVDGTWT GTMNLTEPHC GTDLGLLRTK       180
     AIPNGDGSYR ISGQKIFISA GEHDMAENII HLVLARIEGA PEGVKGISLF IVPKFKLNDD       240
     GEPGARNGVS CGAIEHKMGI HGNSTCVMNY DEATGYLIGA ENKGLNAMFV MMNEARLAVG       300
     MQGLAIAEIA YQNAANYARE RLQGRSLSGV KAPEQKADPI IVHPDVRRSL MTIKAFNEAG       360
     RAFTLWTALK SDIAHRSDNE AERQAADDIL GLMTPILKGV LTDKGFDHTV VAQQLFGGHG       420
     YIEEHGMSQY VRDARIAMIY EGANGIQALD LVGRKLAING GRAVMALFKE IGDFCEENRG       480
     DERLSAYTKA LKKGLNDLQA ATMWFMQNAM AKPDNAGAGS TDYMHLFGLV VLGYMWAKIA       540
     KTAHDKLAAG ETAQADYLKN KLITANFFME RILPETALRK ARIETGADTL MALDAAAF         598
//

If you have problems or comments...

PBIL Back to PBIL home page