(data stored in ACNUC7421 zone)

EMBL: CP001389.PE166

CP001389.PE166       Location/Qualifiers
FT   CDS             189749..193432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01700"
FT                   /product="hypothetical protein contains peptidoglycan
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23970"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR9"
FT                   /protein_id="ACP23970.1"
FT                   /translation="MNGSRSNPQRTGSPSYGDRPSLDALNRTIEGLEARIEGLMSSVGR
FT                   EQRQPDRRAAPANNAVSEILDRQRALSGARERLPLRERISARQSDRPVPAPARLAEEPR
FT                   YQPTPPVPTQPPRPSAATDIAEALVGLRQDLKRDISDGFAREMHALRSEIRGIKAEASE
FT                   DRGYAADIRADLQRLADNINQLGRQAPSAQADALRVEFDDLRAMIDGLAREDSMRRMES
FT                   RWSGVEDRLNAFDQNRDDELVALAYRLDEIKSQIGTLSQVSAVDMLEDKLVVVARAIET
FT                   LGRQMEPDDRRFASQFAELDQRLDEISRAVAVGRNAASLDSAFVNRLENRLGDLSHQID
FT                   NLARPVDAGLGARIEALSARVEDLAGDRAAARLEERLDQLSALLERSQRNVAPELADYL
FT                   ADISRRIEALDQGSVNDVLAERLDYLARRIDELDGHGESPAPDMRFDRLEDRLADIAQR
FT                   LEETQAAPFDDREALRNLEAQIGNLSALVSRSHQEPAGAAPIEFESRMTALEDYLATSD
FT                   EYIIEAARQAAEAVMEAYARNGMPQTASGTDMAAISALAEDLRALEDISRSSEERTART
FT                   FEALHDTLVHIAEKLERLEEREPGAGVRIASPNAPAMPKAVEPEFAGAFNEADLARQGS
FT                   LQRLGTAVDADVDVTVASPVAADLSPSGAASQVAVPAAKAGLLAGLTRRFSAKRNETAP
FT                   AQARQMVEPTPSIDPSEMLAPEDANQLLEPGSGVPDVKKILERVRAGQMARGGQSADGG
FT                   EKADFIAAARRAAQMAVEEADSLKSAKDHKGPSAAGGAFARHRRPILMAVGAVLLAIMS
FT                   YPLVSTMLKDRDAESVQPAAAIERKAEAEIAPKAVGEEAAKPLAAAVAAKPAGLPKAAA
FT                   PVEKTGTPPIATKAAATGGDKPAAAVPAVEAGQAPLLQPVAEPAKSGPVSTFQPTSPGA
FT                   PTVANFAPVKANEIVLPEGFGPPALLTAAKGGDPLAYYEIGTRFTEGRGVKEDLVEAGK
FT                   WYQRAADAGVVPAAYRLANLYEKGAGVARDAAKAKALYQKAAEAGNASASHNLAVMLAS
FT                   GRDGAPDLAAAAKWFEKAADLGVRDSQFNLAVLYARGNGVAQSLEDSYKWFAIAARDGD
FT                   KDAGEKRDEIAKALKPEELASAKAKAEAWKVQPVDAGANTVDVPDAWIGPSTKTASVDM
FT                   TKAVRNIQAILNNNGFDAGAPDGHMGKKTIAAIKAFQKSIGHEPTGEVTDELVKELLKR
FT                   NS"
     MNGSRSNPQR TGSPSYGDRP SLDALNRTIE GLEARIEGLM SSVGREQRQP DRRAAPANNA        60
     VSEILDRQRA LSGARERLPL RERISARQSD RPVPAPARLA EEPRYQPTPP VPTQPPRPSA       120
     ATDIAEALVG LRQDLKRDIS DGFAREMHAL RSEIRGIKAE ASEDRGYAAD IRADLQRLAD       180
     NINQLGRQAP SAQADALRVE FDDLRAMIDG LAREDSMRRM ESRWSGVEDR LNAFDQNRDD       240
     ELVALAYRLD EIKSQIGTLS QVSAVDMLED KLVVVARAIE TLGRQMEPDD RRFASQFAEL       300
     DQRLDEISRA VAVGRNAASL DSAFVNRLEN RLGDLSHQID NLARPVDAGL GARIEALSAR       360
     VEDLAGDRAA ARLEERLDQL SALLERSQRN VAPELADYLA DISRRIEALD QGSVNDVLAE       420
     RLDYLARRID ELDGHGESPA PDMRFDRLED RLADIAQRLE ETQAAPFDDR EALRNLEAQI       480
     GNLSALVSRS HQEPAGAAPI EFESRMTALE DYLATSDEYI IEAARQAAEA VMEAYARNGM       540
     PQTASGTDMA AISALAEDLR ALEDISRSSE ERTARTFEAL HDTLVHIAEK LERLEEREPG       600
     AGVRIASPNA PAMPKAVEPE FAGAFNEADL ARQGSLQRLG TAVDADVDVT VASPVAADLS       660
     PSGAASQVAV PAAKAGLLAG LTRRFSAKRN ETAPAQARQM VEPTPSIDPS EMLAPEDANQ       720
     LLEPGSGVPD VKKILERVRA GQMARGGQSA DGGEKADFIA AARRAAQMAV EEADSLKSAK       780
     DHKGPSAAGG AFARHRRPIL MAVGAVLLAI MSYPLVSTML KDRDAESVQP AAAIERKAEA       840
     EIAPKAVGEE AAKPLAAAVA AKPAGLPKAA APVEKTGTPP IATKAAATGG DKPAAAVPAV       900
     EAGQAPLLQP VAEPAKSGPV STFQPTSPGA PTVANFAPVK ANEIVLPEGF GPPALLTAAK       960
     GGDPLAYYEI GTRFTEGRGV KEDLVEAGKW YQRAADAGVV PAAYRLANLY EKGAGVARDA      1020
     AKAKALYQKA AEAGNASASH NLAVMLASGR DGAPDLAAAA KWFEKAADLG VRDSQFNLAV      1080
     LYARGNGVAQ SLEDSYKWFA IAARDGDKDA GEKRDEIAKA LKPEELASAK AKAEAWKVQP      1140
     VDAGANTVDV PDAWIGPSTK TASVDMTKAV RNIQAILNNN GFDAGAPDGH MGKKTIAAIK      1200
     AFQKSIGHEP TGEVTDELVK ELLKRNS                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page