(data stored in ACNUC7421 zone)

EMBL: CP001389.PE167

CP001389.PE167       Location/Qualifiers
FT   CDS             193822..194748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01710"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23971"
FT                   /db_xref="GOA:C3MFS0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS0"
FT                   /protein_id="ACP23971.1"
FT                   /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTIDIKLGTVLLCGGLVGATLGVWLFSLL
FT                   RSIGQLDLVISLLYVVLLGSVGGLMLWESIGAMRKAARNQPTQLRRPGQHNWIHGLPLK
FT                   MRFKKSKIYLSVIPVATLGFSIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQ
FT                   IVFVSAYTVIVQASTNYTVDIVLAFVLMIAGVIGAQYGVRVGQRLRGEQLRALLALLVL
FT                   AVGIRLAIELIIPPKDIYSVVSAGFGF"
     MTVYLPIAEL SVNIFIILGM GAAVGFLSGM FGVGGGFLIT PLLIFYNIPP VVAVATGANQ        60
     VVASSISGAI THFRRGTIDI KLGTVLLCGG LVGATLGVWL FSLLRSIGQL DLVISLLYVV       120
     LLGSVGGLML WESIGAMRKA ARNQPTQLRR PGQHNWIHGL PLKMRFKKSK IYLSVIPVAT       180
     LGFSIGILTS IMGVGGGFIM VPAMIYLLRI PTSVVVGTSL FQIVFVSAYT VIVQASTNYT       240
     VDIVLAFVLM IAGVIGAQYG VRVGQRLRGE QLRALLALLV LAVGIRLAIE LIIPPKDIYS       300
     VVSAGFGF                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page