(data stored in ACNUC7421 zone)

EMBL: CP001389.PE168

CP001389.PE168       Location/Qualifiers
FT   CDS             194748..195551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01720"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23972"
FT                   /db_xref="GOA:C3MFS1"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS1"
FT                   /protein_id="ACP23972.1"
FT                   /translation="MRALARLVLFAAALTVCGPVAAQSLEREVGDFTEKLEIGISTDEI
FT                   SITSDFRGADLTIFGAIDGFDADLLAQGKYNIIVVLEGPKDNATVRKKQRVFGIWVNTQ
FT                   SMTFELVPEAYSLSSTRDIATIAPPRDIANMGIGVDHMRLVPLGFIGDGSSLGEFRNAF
FT                   RRIREESGVYQRDPGGVQFISSSLFKASVRLPANVPNGIHVVRAYLFRDGLFVAAKALP
FT                   LRVVKTGLEQAITRAAHEQPLIYGFLAVTLAAITGWGASLLFRKE"
     MRALARLVLF AAALTVCGPV AAQSLEREVG DFTEKLEIGI STDEISITSD FRGADLTIFG        60
     AIDGFDADLL AQGKYNIIVV LEGPKDNATV RKKQRVFGIW VNTQSMTFEL VPEAYSLSST       120
     RDIATIAPPR DIANMGIGVD HMRLVPLGFI GDGSSLGEFR NAFRRIREES GVYQRDPGGV       180
     QFISSSLFKA SVRLPANVPN GIHVVRAYLF RDGLFVAAKA LPLRVVKTGL EQAITRAAHE       240
     QPLIYGFLAV TLAAITGWGA SLLFRKE                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page