(data stored in ACNUC7421 zone)

EMBL: CP001389.PE170

CP001389.PE170       Location/Qualifiers
FT   CDS             complement(195958..196689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01740"
FT                   /product="putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23974"
FT                   /db_xref="GOA:C3MFS3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS3"
FT                   /protein_id="ACP23974.1"
FT                   /translation="MTMHRLVHATSAIETSALFQARTTVNGVAAICDALGGLFLPDTRT
FT                   LVVSDLHLEKGSAFARRGMMLPPYDTLATLRILEAIVARYDPATVISLGDNFHDRRGSV
FT                   AMPDTFRQMITAMARGRDWIWINGNHDPDGASGLPGASMDELRHAGLVFRHEPSMADGL
FT                   GEIAGHMHPSATVRRRERSIRRACFATDGRRLLMPAFGVTTGGLDLRHRAMSGLFDRQQ
FT                   LVAHMLGRDRIYSVRFANLLG"
     MTMHRLVHAT SAIETSALFQ ARTTVNGVAA ICDALGGLFL PDTRTLVVSD LHLEKGSAFA        60
     RRGMMLPPYD TLATLRILEA IVARYDPATV ISLGDNFHDR RGSVAMPDTF RQMITAMARG       120
     RDWIWINGNH DPDGASGLPG ASMDELRHAG LVFRHEPSMA DGLGEIAGHM HPSATVRRRE       180
     RSIRRACFAT DGRRLLMPAF GVTTGGLDLR HRAMSGLFDR QQLVAHMLGR DRIYSVRFAN       240
     LLG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page