(data stored in ACNUC7421 zone)

EMBL: CP001389.PE171

CP001389.PE171       Location/Qualifiers
FT   CDS             complement(196951..199599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01750"
FT                   /product="predicted ATP-dependent RNA/DNA helicase protein,
FT                   DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23975"
FT                   /db_xref="GOA:C3MFS4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS4"
FT                   /protein_id="ACP23975.1"
FT                   /translation="MDGLRPSPRINPERGNCAHTASGFSFVSFDLPLFPVDRIDSPLPE
FT                   SDALTLPAPFLRWFAEKGWRPRAHQLELLSRAEAGQSTLLIAPTGAGKTLAGFLPSLVD
FT                   LVRRGRIPPGSAFIGIHTLYISPLKALAVDIERNLMKPVNEMGLPVRIENRTGDTPQAK
FT                   RQRQKLSPPDLLLTTPEQLALLIADGEAERFFKDLRYVVLDELHSLVTSKRGHLLALGL
FT                   ARLRRLAPGLQTIGLSATVAAPMELQRWLVGQTPDEESYAGLITVSGGAKPEISILRAE
FT                   SHVPWAGHSARYAIPDIYAAIKAHGTTLLFVNTRSQAEMLFRELWTINDDNLPIALHHG
FT                   SLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGDVDLVVHVGAPKGASRLAQRIGRA
FT                   NHRMDEPSRAILVPANRFEVMECQAALDANYVGAQDTPPVGKGALDVLAQHVLGMACAK
FT                   PFDPLALYDEITSAAPYADLSWETFERVVDLVATGGYALRTYERYARVRKTKEGLWRVS
FT                   NPMVAQQYRLNVGTIVESPMLNVRMVKRNARGSLGRGGMSLGKVEEYFLEMLSPADTFL
FT                   FSGKVLRFEGIRENECLVSQAFSFDPKVPSYAGGKFPLSTYLAAQVRKMLADPARRATL
FT                   PDQVRDWLALQGDASMLPREDELLVETFPRGSRHYMVTYAFEGRLAHQTLGMLLTRRLD
FT                   RAGLKPLGFVATDYSLGIWALDDMGAAFRAGAPSLAQLFDEDMLGDDLEAWLNESFLLK
FT                   RTFRTCAVIAGLIDQRHPGKEKTGRQVTVSADLIYDVLRMHEPDHILLEATRNDAASGL
FT                   LDIGRLGTMLKRIKGHITHRRLDRISPLAVPVMLEIGRESVHGEAQDFLLTEAADELIN
FT                   EAMGIGQAAGE"
     MDGLRPSPRI NPERGNCAHT ASGFSFVSFD LPLFPVDRID SPLPESDALT LPAPFLRWFA        60
     EKGWRPRAHQ LELLSRAEAG QSTLLIAPTG AGKTLAGFLP SLVDLVRRGR IPPGSAFIGI       120
     HTLYISPLKA LAVDIERNLM KPVNEMGLPV RIENRTGDTP QAKRQRQKLS PPDLLLTTPE       180
     QLALLIADGE AERFFKDLRY VVLDELHSLV TSKRGHLLAL GLARLRRLAP GLQTIGLSAT       240
     VAAPMELQRW LVGQTPDEES YAGLITVSGG AKPEISILRA ESHVPWAGHS ARYAIPDIYA       300
     AIKAHGTTLL FVNTRSQAEM LFRELWTIND DNLPIALHHG SLDVAQRRKV EAAMAENRLR       360
     AVVATSTLDL GIDWGDVDLV VHVGAPKGAS RLAQRIGRAN HRMDEPSRAI LVPANRFEVM       420
     ECQAALDANY VGAQDTPPVG KGALDVLAQH VLGMACAKPF DPLALYDEIT SAAPYADLSW       480
     ETFERVVDLV ATGGYALRTY ERYARVRKTK EGLWRVSNPM VAQQYRLNVG TIVESPMLNV       540
     RMVKRNARGS LGRGGMSLGK VEEYFLEMLS PADTFLFSGK VLRFEGIREN ECLVSQAFSF       600
     DPKVPSYAGG KFPLSTYLAA QVRKMLADPA RRATLPDQVR DWLALQGDAS MLPREDELLV       660
     ETFPRGSRHY MVTYAFEGRL AHQTLGMLLT RRLDRAGLKP LGFVATDYSL GIWALDDMGA       720
     AFRAGAPSLA QLFDEDMLGD DLEAWLNESF LLKRTFRTCA VIAGLIDQRH PGKEKTGRQV       780
     TVSADLIYDV LRMHEPDHIL LEATRNDAAS GLLDIGRLGT MLKRIKGHIT HRRLDRISPL       840
     AVPVMLEIGR ESVHGEAQDF LLTEAADELI NEAMGIGQAA GE                          882
//

If you have problems or comments...

PBIL Back to PBIL home page