(data stored in ACNUC7421 zone)

EMBL: CP001389.PE172

CP001389.PE172       Location/Qualifiers
FT   CDS             complement(199603..200238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01760"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23976"
FT                   /db_xref="GOA:C3MFS5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS5"
FT                   /protein_id="ACP23976.1"
FT                   /translation="MAQTSSVFGLWNTSPTRHTPIEDVQGVFSGSLVAALGLYFLASAG
FT                   LLTGSTAGVAFLLHYATGVNFSLAFFLLNLPFFYLSLKQLGAAFTIKTFIAIGVTSLLT
FT                   DAQSRLFEIEQIHPGWAALLGGLLLGYGVLALYRHRASLGGVGILGVYLQERFGIRAGL
FT                   VQLAIDMVVLGVAFAVTTPWVVLWSVLGAVVLNLFVAINHRADRYIAL"
     MAQTSSVFGL WNTSPTRHTP IEDVQGVFSG SLVAALGLYF LASAGLLTGS TAGVAFLLHY        60
     ATGVNFSLAF FLLNLPFFYL SLKQLGAAFT IKTFIAIGVT SLLTDAQSRL FEIEQIHPGW       120
     AALLGGLLLG YGVLALYRHR ASLGGVGILG VYLQERFGIR AGLVQLAIDM VVLGVAFAVT       180
     TPWVVLWSVL GAVVLNLFVA INHRADRYIA L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page