(data stored in ACNUC7421 zone)

EMBL: CP001389.PE173

CP001389.PE173       Location/Qualifiers
FT   CDS             complement(200343..201281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01770"
FT                   /product="hypothetical protein"
FT                   /note="partial similarity methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23977"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS6"
FT                   /protein_id="ACP23977.1"
FT                   /translation="MAAHQLSSGDLIADRRADYAKMLAESGDHQGAAELMAQALELVPN
FT                   WAAGWFRLADYEEKSGRKEAAVAALRTTLRLNSEDIFGASLKLALLGAGDAPEQPPSTY
FT                   VERLFDDYAERFDQALVEKLDYSVPEKLAALIDRATGAQKFRHVTDLGCGTGLFGERIR
FT                   GRADFLEGFDLSANMLAKAEGKAIYDRLGRADLSLSPDDCGLFGELAEARADLVSAADV
FT                   LMYLGSLESAFTIADRLLAPGGLFAFSVEDAADNVGFVLRPSLRYAHSQAHVASLCAAF
FT                   GLSTIAIERTVIRMDAGLPIAGILFLAGKSA"
     MAAHQLSSGD LIADRRADYA KMLAESGDHQ GAAELMAQAL ELVPNWAAGW FRLADYEEKS        60
     GRKEAAVAAL RTTLRLNSED IFGASLKLAL LGAGDAPEQP PSTYVERLFD DYAERFDQAL       120
     VEKLDYSVPE KLAALIDRAT GAQKFRHVTD LGCGTGLFGE RIRGRADFLE GFDLSANMLA       180
     KAEGKAIYDR LGRADLSLSP DDCGLFGELA EARADLVSAA DVLMYLGSLE SAFTIADRLL       240
     APGGLFAFSV EDAADNVGFV LRPSLRYAHS QAHVASLCAA FGLSTIAIER TVIRMDAGLP       300
     IAGILFLAGK SA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page