(data stored in ACNUC7421 zone)

EMBL: CP001389.PE174

CP001389.PE174       Location/Qualifiers
FT   CDS             201426..201692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01780"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23978"
FT                   /db_xref="GOA:C3MFS7"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS7"
FT                   /protein_id="ACP23978.1"
FT                   /translation="MSDGVNKFLGDSPLRVLVKLVVVSILVGFVMTVFDWRPMDLLDGI
FT                   RDFVVDLWRSGFAALGRVGDYLLLGAAVVIPAFIILRLLSYRR"
     MSDGVNKFLG DSPLRVLVKL VVVSILVGFV MTVFDWRPMD LLDGIRDFVV DLWRSGFAAL        60
     GRVGDYLLLG AAVVIPAFII LRLLSYRR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page