(data stored in ACNUC7421 zone)

EMBL: CP001389.PE175

CP001389.PE175       Location/Qualifiers
FT   CDS             201695..202198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01790"
FT                   /product="conserved hypothetical protein contains SCP-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23979"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS8"
FT                   /protein_id="ACP23979.1"
FT                   /translation="MQDQFFLPRRRLVLSAGAALSLGLVAGCSTTGLLTPDDGTGSDQT
FT                   DATLGYVNTLRKGKGLATLERDPAASVAAMHQAARMARAGKMKHNIGWRDDFADRMKGD
FT                   GVTLPAAENIAMGQDNAERAYEAWFNSPKHLENMLGRYRGLGVAVAQNTASGNRPFWAM
FT                   VLSG"
     MQDQFFLPRR RLVLSAGAAL SLGLVAGCST TGLLTPDDGT GSDQTDATLG YVNTLRKGKG        60
     LATLERDPAA SVAAMHQAAR MARAGKMKHN IGWRDDFADR MKGDGVTLPA AENIAMGQDN       120
     AERAYEAWFN SPKHLENMLG RYRGLGVAVA QNTASGNRPF WAMVLSG                     167
//

If you have problems or comments...

PBIL Back to PBIL home page