(data stored in ACNUC7421 zone)

EMBL: CP001389.PE178

CP001389.PE178       Location/Qualifiers
FT   CDS             complement(204675..205043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23982"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT1"
FT                   /protein_id="ACP23982.1"
FT                   /translation="MTDERTKMNATIYKIVPALLWQEARRAGQFAGAPIDLADGFIHFS
FT                   THDQVAETAARHFEGQTDLLLVAVDADALGDKLVYEPSRGGALFPHLYAPLTLDAVRWE
FT                   KPLPLGADGKHIFPELAP"
     MTDERTKMNA TIYKIVPALL WQEARRAGQF AGAPIDLADG FIHFSTHDQV AETAARHFEG        60
     QTDLLLVAVD ADALGDKLVY EPSRGGALFP HLYAPLTLDA VRWEKPLPLG ADGKHIFPEL       120
     AP                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page