(data stored in ACNUC7421 zone)

EMBL: CP001389.PE18

CP001389.PE18        Location/Qualifiers
FT   CDS             complement(16666..17493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00180"
FT                   /product="predicted ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23822"
FT                   /db_xref="GOA:C3MEJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ9"
FT                   /protein_id="ACP23822.1"
FT                   /translation="MQDSDVQIPFLPKRKRVKKPSAAAVAARTVDKARYDGTLIARGLT
FT                   KSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDVTT
FT                   MPMYRRARLGVGYLPQEASILRGLTVEENIRAVLEIHDKNVDRRESKLNDLLGEFSITH
FT                   LRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQALVRHLTSRGI
FT                   GVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLGDNFSL"
     MQDSDVQIPF LPKRKRVKKP SAAAVAARTV DKARYDGTLI ARGLTKSYRS RRVVNGVSLV        60
     VRRGEAVGLL GPNGAGKTTC FYMITGLVPV DEGSIEINGN DVTTMPMYRR ARLGVGYLPQ       120
     EASILRGLTV EENIRAVLEI HDKNVDRRES KLNDLLGEFS ITHLRKSPAI ALSGGERRRL       180
     EIARALATDP TFMLLDEPFA GVDPISVADI QALVRHLTSR GIGVLITDHN VRETLGLIDR       240
     AYIIHAGEVL THGRANDIVT NPDVRRLYLG DNFSL                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page