(data stored in ACNUC7421 zone)

EMBL: CP001389.PE181

CP001389.PE181       Location/Qualifiers
FT   CDS             complement(206552..210058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01850"
FT                   /product="predicted two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23985"
FT                   /db_xref="GOA:C3MFT4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT4"
FT                   /protein_id="ACP23985.1"
FT                   /translation="MLSGSVILASAFAYLLLLFAVASYGDRRASRSKIASKGRPLVYAL
FT                   SLAIYCTSWTYFGGVGLAAEHGLEFTGIYIGPILMFTLGMPLIRRIVRLAKTEKLTSVA
FT                   DFVAARYGKNPAVAAIVALISLVGAIPYIALQLKAVSSSVAAMIDTSDYGIGAGENFID
FT                   LPLLVTLFLACFAIVFGTRHTDATEHQDGLILAIAMESVVKLVAMLTAGIYIVFVLFDG
FT                   PANLLAAAQQSPAVLSALEYQTPVARWILLIVLSSFGIIMLPRQFHVTVVENRTENELR
FT                   TAGILFPLYLIAINLFVLPIAIAGILTFSGSGDADLYLLALPLAGDVPFITLLTFIGGF
FT                   SAATAMVIVASVALSIMISNDIVMPVFLRQRLGTRGTLQESMAGTLLNIRRTAIFAVLL
FT                   LGYSYYRSADMSAGLASLGLLSFVAISQMAPALLGGLVWRQANARGAIAGMVSGFLVWA
FT                   YALFLPSLGGPDNSHVASTILSFLLPFTDLFSGPQSDPLVNASALSLLVNVFAYVLGSL
FT                   TRTPKPLERFQAGVFITRRSRTERAFRGRKTKVTVRDLKTTIARYMGDERMQRSFHTYE
FT                   QQSGRWLDENASADMALVHFSEQLLGSAIGSSSARLVFSLVLQRMDDPSSDTAWLLDQA
FT                   SEALQHNQDMLQTALSQMDQGIAVFDNASNLIIWNRRFRELLDLPEAAGQVGFPLADIV
FT                   AILARRGDIRKDEEKTLVANFLALDKPFLLELGNGTRIVEVRTNAMPDKGIVTTYTDIT
FT                   PRVAADMALKQANETLELRVAERTSELTRVNRELGEARAVAEDANIGKTRFFAAAGHDI
FT                   LQPLNAARLYSSSLVERLGDSDNKALVQNIDSSLESVEAILGAVLDISRLDTGAMKPRL
FT                   QAVPLNDLLRRIETDFAPMARAKDIAFTVMPTSLVVRSDPNLLRRVVQNLVSNAIKYTL
FT                   EGKVLVGVRQHGQTATIEVLDSGIGIPASKFRTVFKEFARLDEGARTASGLGLGLSIVD
FT                   RISRVLNHPVGLQSKPGKGTGFKVSVPLDTSATEPARPQPVAATKTSEALTGLAVVCID
FT                   NEPKILEGMALLLGGWGCAVTTVESVAACARMGPGNLPARPDAIVADYHLDDGTGIEAI
FT                   AAIRALWQESIPALMVTADRTPEVRGAAERDGVSLQHKPVRPAALRAWLTQLAAAGRTA
FT                   AE"
     MLSGSVILAS AFAYLLLLFA VASYGDRRAS RSKIASKGRP LVYALSLAIY CTSWTYFGGV        60
     GLAAEHGLEF TGIYIGPILM FTLGMPLIRR IVRLAKTEKL TSVADFVAAR YGKNPAVAAI       120
     VALISLVGAI PYIALQLKAV SSSVAAMIDT SDYGIGAGEN FIDLPLLVTL FLACFAIVFG       180
     TRHTDATEHQ DGLILAIAME SVVKLVAMLT AGIYIVFVLF DGPANLLAAA QQSPAVLSAL       240
     EYQTPVARWI LLIVLSSFGI IMLPRQFHVT VVENRTENEL RTAGILFPLY LIAINLFVLP       300
     IAIAGILTFS GSGDADLYLL ALPLAGDVPF ITLLTFIGGF SAATAMVIVA SVALSIMISN       360
     DIVMPVFLRQ RLGTRGTLQE SMAGTLLNIR RTAIFAVLLL GYSYYRSADM SAGLASLGLL       420
     SFVAISQMAP ALLGGLVWRQ ANARGAIAGM VSGFLVWAYA LFLPSLGGPD NSHVASTILS       480
     FLLPFTDLFS GPQSDPLVNA SALSLLVNVF AYVLGSLTRT PKPLERFQAG VFITRRSRTE       540
     RAFRGRKTKV TVRDLKTTIA RYMGDERMQR SFHTYEQQSG RWLDENASAD MALVHFSEQL       600
     LGSAIGSSSA RLVFSLVLQR MDDPSSDTAW LLDQASEALQ HNQDMLQTAL SQMDQGIAVF       660
     DNASNLIIWN RRFRELLDLP EAAGQVGFPL ADIVAILARR GDIRKDEEKT LVANFLALDK       720
     PFLLELGNGT RIVEVRTNAM PDKGIVTTYT DITPRVAADM ALKQANETLE LRVAERTSEL       780
     TRVNRELGEA RAVAEDANIG KTRFFAAAGH DILQPLNAAR LYSSSLVERL GDSDNKALVQ       840
     NIDSSLESVE AILGAVLDIS RLDTGAMKPR LQAVPLNDLL RRIETDFAPM ARAKDIAFTV       900
     MPTSLVVRSD PNLLRRVVQN LVSNAIKYTL EGKVLVGVRQ HGQTATIEVL DSGIGIPASK       960
     FRTVFKEFAR LDEGARTASG LGLGLSIVDR ISRVLNHPVG LQSKPGKGTG FKVSVPLDTS      1020
     ATEPARPQPV AATKTSEALT GLAVVCIDNE PKILEGMALL LGGWGCAVTT VESVAACARM      1080
     GPGNLPARPD AIVADYHLDD GTGIEAIAAI RALWQESIPA LMVTADRTPE VRGAAERDGV      1140
     SLQHKPVRPA ALRAWLTQLA AAGRTAAE                                         1168
//

If you have problems or comments...

PBIL Back to PBIL home page