(data stored in ACNUC7421 zone)

EMBL: CP001389.PE186

CP001389.PE186       Location/Qualifiers
FT   CDS             complement(214304..215308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01900"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23990"
FT                   /db_xref="GOA:C3MFT9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT9"
FT                   /protein_id="ACP23990.1"
FT                   /translation="MALDLPFIWAALIAFAVLAYVVLDGFDLGVGILFPLFPEKHDRDV
FT                   MMNSVAPVWDGNETWLVLGGGGLMAVFPLAYATIMPALYAPIIAMLIGLIFRGVAFEYR
FT                   WRTKRAEYLWNWAFAGGSTLAAFAQGLALGALVQGIPIEDRAYAGGWWDWLTPFSIVTG
FT                   VAIVVGYALLGATWLIMKTRGDLAERARSIALKCAFGTIAAMGIVSLWTPFLERVYLQR
FT                   WFGWPTAIFSVIVPLLVLGCLYLLLKGIQERRDAQPFLAALGLFVLGYIGIGISFYPYM
FT                   VPPSLTIWDAAAPNESLAFLLVGALVLVPIILAYTAYAYWVFRGKVDPEEGYH"
     MALDLPFIWA ALIAFAVLAY VVLDGFDLGV GILFPLFPEK HDRDVMMNSV APVWDGNETW        60
     LVLGGGGLMA VFPLAYATIM PALYAPIIAM LIGLIFRGVA FEYRWRTKRA EYLWNWAFAG       120
     GSTLAAFAQG LALGALVQGI PIEDRAYAGG WWDWLTPFSI VTGVAIVVGY ALLGATWLIM       180
     KTRGDLAERA RSIALKCAFG TIAAMGIVSL WTPFLERVYL QRWFGWPTAI FSVIVPLLVL       240
     GCLYLLLKGI QERRDAQPFL AALGLFVLGY IGIGISFYPY MVPPSLTIWD AAAPNESLAF       300
     LLVGALVLVP IILAYTAYAY WVFRGKVDPE EGYH                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page