(data stored in ACNUC7421 zone)

EMBL: CP001389.PE187

CP001389.PE187       Location/Qualifiers
FT   CDS             complement(215298..216713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01910"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23991"
FT                   /db_xref="GOA:C3MFU0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU0"
FT                   /protein_id="ACP23991.1"
FT                   /translation="MFEAFDATLLARIQFAFTVSFHIIFPAFSIGLASYLAVLEALWLW
FT                   KKDAVYLELFNFWKTIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPIIGPLMGYEVL
FT                   TAFFLEAGFLGIMLFGLNRVGPRLHFLATVMVAIGTLISATWILSANSWMQTPAGFATN
FT                   EAGQFIPVDWWAIIFNPSFPYRLVHMVLAAYLTTALVVGACGAWHLLHNTAPRRARTMF
FT                   SMAMWMAAIVAPIQIFAGDQHGLNTLEHQPAKVMAMEGHYHSHPDGAPLVLFGIPNSAE
FT                   KRIDYAIEVPKLGSLILKHDLDAPLAGLDTIPDELHPPVAVVFWSFRVMVGMGLAMLGI
FT                   GLWSLWCRYRGTLDGDIWLHRAAVLMGPAGFVAVLAGWITTEVGRQPYTVYGHLLTANS
FT                   IAPIEAPAIGASLVAFIVVYFLVFGAGTFYILRLMARLPRDTMPELDEGPLRTAGVTPG
FT                   PATAKPHGGHHGS"
     MFEAFDATLL ARIQFAFTVS FHIIFPAFSI GLASYLAVLE ALWLWKKDAV YLELFNFWKT        60
     IFAVAFGMGV VSGIVMSYQF GTNWSVFSDK AGPIIGPLMG YEVLTAFFLE AGFLGIMLFG       120
     LNRVGPRLHF LATVMVAIGT LISATWILSA NSWMQTPAGF ATNEAGQFIP VDWWAIIFNP       180
     SFPYRLVHMV LAAYLTTALV VGACGAWHLL HNTAPRRART MFSMAMWMAA IVAPIQIFAG       240
     DQHGLNTLEH QPAKVMAMEG HYHSHPDGAP LVLFGIPNSA EKRIDYAIEV PKLGSLILKH       300
     DLDAPLAGLD TIPDELHPPV AVVFWSFRVM VGMGLAMLGI GLWSLWCRYR GTLDGDIWLH       360
     RAAVLMGPAG FVAVLAGWIT TEVGRQPYTV YGHLLTANSI APIEAPAIGA SLVAFIVVYF       420
     LVFGAGTFYI LRLMARLPRD TMPELDEGPL RTAGVTPGPA TAKPHGGHHG S                471
//

If you have problems or comments...

PBIL Back to PBIL home page