(data stored in ACNUC7421 zone)

EMBL: CP001389.PE189

CP001389.PE189       Location/Qualifiers
FT   CDS             complement(218077..218901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01930"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23993"
FT                   /db_xref="GOA:C3MFU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU2"
FT                   /protein_id="ACP23993.1"
FT                   /translation="MTDETTHALALVPEDLPKAEAFLKPHRIVLMLVFAGLIVAIAVFM
FT                   RWDWLPRYLPRLGSGILVSLAMLFSTAILGFLLAVPLGLVQVTGPWFLKAPARLFCTVI
FT                   RGTPLLLQLWLLYYGLGSLFPQFPAIRHSLLWPYLREAWPYGVAALTLSFAAYEGEVMR
FT                   GAFAGVPQGELEAARAYGMGRWTTFRRIWLPRAVHRALPTLNGETVLQLKSTPLVATIT
FT                   VVDVYAVISKVRQETFLTYEPLLLLALIYLCLTGILVVAFRYFENRIPTRGA"
     MTDETTHALA LVPEDLPKAE AFLKPHRIVL MLVFAGLIVA IAVFMRWDWL PRYLPRLGSG        60
     ILVSLAMLFS TAILGFLLAV PLGLVQVTGP WFLKAPARLF CTVIRGTPLL LQLWLLYYGL       120
     GSLFPQFPAI RHSLLWPYLR EAWPYGVAAL TLSFAAYEGE VMRGAFAGVP QGELEAARAY       180
     GMGRWTTFRR IWLPRAVHRA LPTLNGETVL QLKSTPLVAT ITVVDVYAVI SKVRQETFLT       240
     YEPLLLLALI YLCLTGILVV AFRYFENRIP TRGA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page