(data stored in ACNUC7421 zone)

EMBL: CP001389.PE19

CP001389.PE19        Location/Qualifiers
FT   CDS             complement(17493..18056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00190"
FT                   /product="putative OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23823"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK0"
FT                   /protein_id="ACP23823.1"
FT                   /translation="MSVTSTVSFKVSASLAAAGIGALIIASGALAQATSSRMKGMQLSN
FT                   DQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKATEGATITSGNADI
FT                   DRIEVNNKVFLSSGAQQATGDTGLVNLTNQTIVLKGDKVVLSEGKNVFVGCQLNVQMDT
FT                   GEAQLEACGGRVQIQLDPQSRKQN"
     MSVTSTVSFK VSASLAAAGI GALIIASGAL AQATSSRMKG MQLSNDQPIQ IESDKLEIKD        60
     PESKAIFTGN VKVVQGTTTL QAGNMTVFYK ATEGATITSG NADIDRIEVN NKVFLSSGAQ       120
     QATGDTGLVN LTNQTIVLKG DKVVLSEGKN VFVGCQLNVQ MDTGEAQLEA CGGRVQIQLD       180
     PQSRKQN                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page