(data stored in ACNUC7421 zone)

EMBL: CP001389.PE190

CP001389.PE190       Location/Qualifiers
FT   CDS             complement(218898..219623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01940"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23994"
FT                   /db_xref="GOA:C3MFU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU3"
FT                   /protein_id="ACP23994.1"
FT                   /translation="MAADSLINWSLLALAAPGWGGVLLQGFLHSIEIAIGGYALGLLLG
FT                   VGGAFGKLYGGPVLRDLLECYTTIVRAVPELVLILLLYYAGTDLLNQFLGAMGIGTVDI
FT                   SGLMAGIFVIGVVQGAYSTEVLRGAIKAVPAGQIEAARAYGMSPTKVLRRITLPAMLPY
FT                   AIPGLANLWLIATKDTALLAVVGFSELTLVTRQAAGTTKAYFLFFCAAGALYLVLTLVS
FT                   NLFIGVIERHARRGFAERR"
     MAADSLINWS LLALAAPGWG GVLLQGFLHS IEIAIGGYAL GLLLGVGGAF GKLYGGPVLR        60
     DLLECYTTIV RAVPELVLIL LLYYAGTDLL NQFLGAMGIG TVDISGLMAG IFVIGVVQGA       120
     YSTEVLRGAI KAVPAGQIEA ARAYGMSPTK VLRRITLPAM LPYAIPGLAN LWLIATKDTA       180
     LLAVVGFSEL TLVTRQAAGT TKAYFLFFCA AGALYLVLTL VSNLFIGVIE RHARRGFAER       240
     R                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page