(data stored in ACNUC7421 zone)

EMBL: CP001389.PE195

CP001389.PE195       Location/Qualifiers
FT   CDS             223486..225099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01990"
FT                   /product="predicted thiamine pyrophosphate protein, TPP
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23999"
FT                   /db_xref="GOA:C3MFU8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU8"
FT                   /protein_id="ACP23999.1"
FT                   /translation="MSVETKTVGEVLVDLLEANGVEVVFGIPGVHTVELYRGLAASKIR
FT                   HVTPRHEQGAGFMADGYARVSGKPGVALVITGPGLTNTITAMAQARQDSIPMLVISGVN
FT                   RRDSLGHGRGLLHELPDQQGMMKTLALYSHTLINPADLPLVVDRAFAVLLSGRPGPVHI
FT                   EIPTDVMAERIESRGTKPAAATRPRSDGETLQRAAILCAEASRPVILCGGGALTAEAEV
FT                   RGLAEQIGAPVVTTVNARGMLAGHPLRVPASPSLKAVRALLRDADLVLALGTEMGQTDY
FT                   DLYADGGFPMLRNLIRTDIDAAQLARGPQAALSVLSGARAATAGILGFLPGHTAARDGA
FT                   SRADATRKAALKELTPKMRAEVGIIDLIYKALPDCTIVGDSTQAVYAGNLYCDAPRQRA
FT                   WFNSATGYGSLGYAPPAAVGAAVADRARPVVCLVGDGGFQFSLAEIGSAVDAGARVIFL
FT                   VWNNDGYREIESHMVEAGVTPEGVKPSAPDFLLTAGAYGVPAERLAKIGDLPRALADAA
FT                   SRSGPSLIEIHQEKTAGVGG"
     MSVETKTVGE VLVDLLEANG VEVVFGIPGV HTVELYRGLA ASKIRHVTPR HEQGAGFMAD        60
     GYARVSGKPG VALVITGPGL TNTITAMAQA RQDSIPMLVI SGVNRRDSLG HGRGLLHELP       120
     DQQGMMKTLA LYSHTLINPA DLPLVVDRAF AVLLSGRPGP VHIEIPTDVM AERIESRGTK       180
     PAAATRPRSD GETLQRAAIL CAEASRPVIL CGGGALTAEA EVRGLAEQIG APVVTTVNAR       240
     GMLAGHPLRV PASPSLKAVR ALLRDADLVL ALGTEMGQTD YDLYADGGFP MLRNLIRTDI       300
     DAAQLARGPQ AALSVLSGAR AATAGILGFL PGHTAARDGA SRADATRKAA LKELTPKMRA       360
     EVGIIDLIYK ALPDCTIVGD STQAVYAGNL YCDAPRQRAW FNSATGYGSL GYAPPAAVGA       420
     AVADRARPVV CLVGDGGFQF SLAEIGSAVD AGARVIFLVW NNDGYREIES HMVEAGVTPE       480
     GVKPSAPDFL LTAGAYGVPA ERLAKIGDLP RALADAASRS GPSLIEIHQE KTAGVGG          537
//

If you have problems or comments...

PBIL Back to PBIL home page