(data stored in ACNUC7421 zone)

EMBL: CP001389.PE196

CP001389.PE196       Location/Qualifiers
FT   CDS             225260..225667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24000"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU9"
FT                   /protein_id="ACP24000.1"
FT                   /translation="MDLLGGGSRNMQASRLLAVLWLFCASFAMQVITVGQSVSSRVGAQ
FT                   GGNVSAPDGGSPDRPAARQVSRAVALPELRIVGERPDGKSTLGGDPVAILAAEAATLPI
FT                   YEDIRPLFFTRTEVAVGSRHDSERIRGPPAV"
     MDLLGGGSRN MQASRLLAVL WLFCASFAMQ VITVGQSVSS RVGAQGGNVS APDGGSPDRP        60
     AARQVSRAVA LPELRIVGER PDGKSTLGGD PVAILAAEAA TLPIYEDIRP LFFTRTEVAV       120
     GSRHDSERIR GPPAV                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page