(data stored in ACNUC7421 zone)

EMBL: CP001389.PE198

CP001389.PE198       Location/Qualifiers
FT   CDS             complement(228547..228714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24002"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV1"
FT                   /protein_id="ACP24002.1"
FT                   /translation="MRPFTVARQREREPQKAAVETVLDMSLSFGWAGHMAPRRFMNNAK
FT                   RSPSASPFAN"
     MRPFTVARQR EREPQKAAVE TVLDMSLSFG WAGHMAPRRF MNNAKRSPSA SPFAN             55
//

If you have problems or comments...

PBIL Back to PBIL home page