(data stored in ACNUC7421 zone)

EMBL: CP001389.PE199

CP001389.PE199       Location/Qualifiers
FT   CDS             228814..229023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24003"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV2"
FT                   /protein_id="ACP24003.1"
FT                   /translation="MSKQVIEYGGEAVGVVVPDQDRLKFLAVKYHVWDLDAQRFGSADE
FT                   ARAAIRHLLAGKGAPPRHEVGAAA"
     MSKQVIEYGG EAVGVVVPDQ DRLKFLAVKY HVWDLDAQRF GSADEARAAI RHLLAGKGAP        60
     PRHEVGAAA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page