(data stored in ACNUC7421 zone)

EMBL: CP001389.PE2

CP001389.PE2         Location/Qualifiers
FT   CDS             1807..2181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00020"
FT                   /product="hypothetical protein, DGPFAETKE family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23806"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI3"
FT                   /protein_id="ACP23806.1"
FT                   /translation="MLYAVLCYNTEDVTSAWTKEQDDKVMRDLTAVQRKYVEAGKLGPV
FT                   ARLLPTTAATTLRHRPGETVVIDGPFAETKEQLLGFYLIDCASLDEALEFARELSAANP
FT                   AAGSYEIRPLSLYKPGELAP"
     MLYAVLCYNT EDVTSAWTKE QDDKVMRDLT AVQRKYVEAG KLGPVARLLP TTAATTLRHR        60
     PGETVVIDGP FAETKEQLLG FYLIDCASLD EALEFARELS AANPAAGSYE IRPLSLYKPG       120
     ELAP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page