(data stored in ACNUC7421 zone)

EMBL: CP001389.PE20

CP001389.PE20        Location/Qualifiers
FT   CDS             complement(18073..18792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00200"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23824"
FT                   /db_xref="GOA:C3MEK1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK1"
FT                   /protein_id="ACP23824.1"
FT                   /translation="MRILQISQEPNGTDGPLMLNQARYPDILADSGTSPADAYASAARH
FT                   SARVKRLKIVLPFAAGVIALVFAAISFVRAFLPEDLQLETATIENGKIVMQNPAISGRN
FT                   RQDISYSMKAQRALQDIANPDIITLEQIHAEMPVNDTLVATVDATSGIYDRGANTLDMN
FT                   APFTISMNNGVNADFQSAYLDIDAGEMETKHPIAISMNGGSIIAQSLRMTDKGRIVTFE
FT                   GMVRVNVEPSAIRKNAK"
     MRILQISQEP NGTDGPLMLN QARYPDILAD SGTSPADAYA SAARHSARVK RLKIVLPFAA        60
     GVIALVFAAI SFVRAFLPED LQLETATIEN GKIVMQNPAI SGRNRQDISY SMKAQRALQD       120
     IANPDIITLE QIHAEMPVND TLVATVDATS GIYDRGANTL DMNAPFTISM NNGVNADFQS       180
     AYLDIDAGEM ETKHPIAISM NGGSIIAQSL RMTDKGRIVT FEGMVRVNVE PSAIRKNAK        239
//

If you have problems or comments...

PBIL Back to PBIL home page