(data stored in ACNUC7421 zone)

EMBL: CP001389.PE203

CP001389.PE203       Location/Qualifiers
FT   CDS             complement(233376..234179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02070"
FT                   /product="follicular variant translocation protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24007"
FT                   /db_xref="GOA:C3MFV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV6"
FT                   /protein_id="ACP24007.1"
FT                   /translation="MTHVIITGGSSGIGLALASLYASRGARLSLIARSRDLLELAAQTL
FT                   VSKYGARQGDIHIEAADVANEAKIGPAIGRCIEALGPCDILVTSAGIVEPAPFLDASSA
FT                   AFRRQMETNFSGTVHAVRAVYPDMVQRRSGHIVMISSGSGLIGIYGYTAYCASKFALRG
FT                   FAEALRSEARCHGVGVSVGYPPDTETPQFEREIAERPREASVVMGVVRPWSAEAVARKI
FT                   VDGIDRKRFEIYFGLTLFLLGRFGPAVRPLINWWFDRAIERSRGR"
     MTHVIITGGS SGIGLALASL YASRGARLSL IARSRDLLEL AAQTLVSKYG ARQGDIHIEA        60
     ADVANEAKIG PAIGRCIEAL GPCDILVTSA GIVEPAPFLD ASSAAFRRQM ETNFSGTVHA       120
     VRAVYPDMVQ RRSGHIVMIS SGSGLIGIYG YTAYCASKFA LRGFAEALRS EARCHGVGVS       180
     VGYPPDTETP QFEREIAERP REASVVMGVV RPWSAEAVAR KIVDGIDRKR FEIYFGLTLF       240
     LLGRFGPAVR PLINWWFDRA IERSRGR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page