(data stored in ACNUC7421 zone)

EMBL: CP001389.PE206

CP001389.PE206       Location/Qualifiers
FT   CDS             243617..244840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02100"
FT                   /product="putative polysaccharide biosynthesis/export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24010"
FT                   /db_xref="GOA:C3MFV9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV9"
FT                   /protein_id="ACP24010.1"
FT                   /translation="MESSLCRIRSEVVKRVTALLLCTALAGCQAVPGEGPLTSDIVAEA
FT                   GQSGSQIGRKNATVFDIIDIDGQSARLVSEYVATTLSRRFGIGGGVGQVVIGVGDQLKV
FT                   TIFEAGSDGLFSTTESKQTSIDLVVQPDGKAAIPYVGSVRFAGLTLEQARQAILDALKQ
FT                   KAVEPDVIVTSTSTASRIVTVSGAVGRPSVVPLNLVSETINEVIAKAGGPSAQPYETYV
FT                   TLVRGKKTGTVLLKSIIESPSENIHVKQGDQIFVTRDPRTFTILGQVRANQRVEFGAND
FT                   LNLLEAVALAGGGADRTIDAKGYFVFRYEEPDIVMSLLGRERFNTMLSKGMQPDRVGRY
FT                   PIVYRFNMTNPDSLIVGQTFPIKNRDVIYASRHPSVDITKFMDFIARPIGIANSGVNIA
FT                   DNLDDLNN"
     MESSLCRIRS EVVKRVTALL LCTALAGCQA VPGEGPLTSD IVAEAGQSGS QIGRKNATVF        60
     DIIDIDGQSA RLVSEYVATT LSRRFGIGGG VGQVVIGVGD QLKVTIFEAG SDGLFSTTES       120
     KQTSIDLVVQ PDGKAAIPYV GSVRFAGLTL EQARQAILDA LKQKAVEPDV IVTSTSTASR       180
     IVTVSGAVGR PSVVPLNLVS ETINEVIAKA GGPSAQPYET YVTLVRGKKT GTVLLKSIIE       240
     SPSENIHVKQ GDQIFVTRDP RTFTILGQVR ANQRVEFGAN DLNLLEAVAL AGGGADRTID       300
     AKGYFVFRYE EPDIVMSLLG RERFNTMLSK GMQPDRVGRY PIVYRFNMTN PDSLIVGQTF       360
     PIKNRDVIYA SRHPSVDITK FMDFIARPIG IANSGVNIAD NLDDLNN                     407
//

If you have problems or comments...

PBIL Back to PBIL home page