(data stored in ACNUC7421 zone)

EMBL: CP001389.PE211

CP001389.PE211       Location/Qualifiers
FT   CDS             248060..250324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02150"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24015"
FT                   /db_xref="GOA:C3MFW4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW4"
FT                   /protein_id="ACP24015.1"
FT                   /translation="MAQSDAASKIGPENQGPEEAEPSRDHPGRSDGAAFPKTRKALAGL
FT                   GRALTRLGRALRAEVPVAAHRAGEKSKAAALGAFERLRRTSSGKAGSSASAGRSASRWL
FT                   KARRGAASEDRQVMPKRPIGRRAILLRSAAAATLASFVLLAVVFAWALRDVPWNEIAKG
FT                   SLKPVVVLEAADGKPLVSQGPFQGSYAARKDFPPHLVEAVLAREDRRFYEHSGIDLRGI
FT                   ARAIYTNLGAGEVVQGGSTITQQLIKILYLERDRTWKRKIQEAVIAFWLERKLGKDEIL
FT                   TRYLNNIYLGAGATGVPAAARIYFDKEVQDLNIGESAMLAAIIRAPSQLNPLTNPEGAR
FT                   QQAELVLDAMVKGDRITPEEAKVARADVGKLQPTSPAIRSGSWFADWIMQDARELAGPY
FT                   RGTIKVRTTMAPRLQAIAEKVVADALKREGPKAGASQAALVAMTPEGAVVAMVGGRDYT
FT                   KSTFNRAVQAMRQPGSAFKLFVYYAALKRGLTPFDPVEDAPIEINGWSPENFGGGYRGV
FT                   VSIAEAFARSLNAATVALAMEVGIDEVIAAARELGIDAKLADTPSLALGSSEVNLLDLT
FT                   GAYASVRAGRAPIEPWGIEALHAEGQPQAFRVGPSREAATDISQYRPDLVSLLRLVVQR
FT                   GTGREADIGTFAAGKTGTSQNHRDAWFVGFTEPLIVGVWVGNDDETPMKDVTGGKLPAR
FT                   IWKNFMTAALAAGTPEESEAQAAGSAPACNFRACARAYRSFRPDDCTFQPYYGPRRLCE
FT                   K"
     MAQSDAASKI GPENQGPEEA EPSRDHPGRS DGAAFPKTRK ALAGLGRALT RLGRALRAEV        60
     PVAAHRAGEK SKAAALGAFE RLRRTSSGKA GSSASAGRSA SRWLKARRGA ASEDRQVMPK       120
     RPIGRRAILL RSAAAATLAS FVLLAVVFAW ALRDVPWNEI AKGSLKPVVV LEAADGKPLV       180
     SQGPFQGSYA ARKDFPPHLV EAVLAREDRR FYEHSGIDLR GIARAIYTNL GAGEVVQGGS       240
     TITQQLIKIL YLERDRTWKR KIQEAVIAFW LERKLGKDEI LTRYLNNIYL GAGATGVPAA       300
     ARIYFDKEVQ DLNIGESAML AAIIRAPSQL NPLTNPEGAR QQAELVLDAM VKGDRITPEE       360
     AKVARADVGK LQPTSPAIRS GSWFADWIMQ DARELAGPYR GTIKVRTTMA PRLQAIAEKV       420
     VADALKREGP KAGASQAALV AMTPEGAVVA MVGGRDYTKS TFNRAVQAMR QPGSAFKLFV       480
     YYAALKRGLT PFDPVEDAPI EINGWSPENF GGGYRGVVSI AEAFARSLNA ATVALAMEVG       540
     IDEVIAAARE LGIDAKLADT PSLALGSSEV NLLDLTGAYA SVRAGRAPIE PWGIEALHAE       600
     GQPQAFRVGP SREAATDISQ YRPDLVSLLR LVVQRGTGRE ADIGTFAAGK TGTSQNHRDA       660
     WFVGFTEPLI VGVWVGNDDE TPMKDVTGGK LPARIWKNFM TAALAAGTPE ESEAQAAGSA       720
     PACNFRACAR AYRSFRPDDC TFQPYYGPRR LCEK                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page