(data stored in ACNUC7421 zone)

EMBL: CP001389.PE213

CP001389.PE213       Location/Qualifiers
FT   CDS             250837..251283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24017"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW6"
FT                   /protein_id="ACP24017.1"
FT                   /translation="MRGHHFTLSPTCPRRTSGFGRSLKPINRPGGQAPLRRIGSRGADP
FT                   SPRAAEGIRQCSGPAVAHTRGGLFSGVVAQHSAPPMPLRKSPKSAAEGTSGGVLDVPPW
FT                   HMRITDDLGRNLLGANVLTGIAPEQTAHEYMRLAKADQQERSAA"
     MRGHHFTLSP TCPRRTSGFG RSLKPINRPG GQAPLRRIGS RGADPSPRAA EGIRQCSGPA        60
     VAHTRGGLFS GVVAQHSAPP MPLRKSPKSA AEGTSGGVLD VPPWHMRITD DLGRNLLGAN       120
     VLTGIAPEQT AHEYMRLAKA DQQERSAA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page