(data stored in ACNUC7421 zone)

EMBL: CP001389.PE215

CP001389.PE215       Location/Qualifiers
FT   CDS             252165..252563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24019"
FT                   /db_xref="GOA:C3MFW8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW8"
FT                   /protein_id="ACP24019.1"
FT                   /translation="MAWLSEVLDQTTVLSLLAGIVVGLPAYFVVSALIRDDRPSPAPRR
FT                   SPRRRKRSSIPGIAVAAAIALFGVSQYVPLIPGCDIKGNVSYNSGERIYHIPGQEDYGQ
FT                   TRVNYFDGERWFCSEASAREAGWRRAYN"
     MAWLSEVLDQ TTVLSLLAGI VVGLPAYFVV SALIRDDRPS PAPRRSPRRR KRSSIPGIAV        60
     AAAIALFGVS QYVPLIPGCD IKGNVSYNSG ERIYHIPGQE DYGQTRVNYF DGERWFCSEA       120
     SAREAGWRRA YN                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page