(data stored in ACNUC7421 zone)

EMBL: CP001389.PE216

CP001389.PE216       Location/Qualifiers
FT   CDS             253174..253392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24020"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW9"
FT                   /protein_id="ACP24020.1"
FT                   /translation="MHMQNDDDKDHAPGPRRGAKAGKSEAEVKRERLAKTLRDNLQRRK
FT                   QQARARRAGDADETSGLPAAKTDESDD"
     MHMQNDDDKD HAPGPRRGAK AGKSEAEVKR ERLAKTLRDN LQRRKQQARA RRAGDADETS        60
     GLPAAKTDES DD                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page