(data stored in ACNUC7421 zone)

EMBL: CP001389.PE218

CP001389.PE218       Location/Qualifiers
FT   CDS             255039..255479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24022"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX1"
FT                   /protein_id="ACP24022.1"
FT                   /translation="MDALKLLALDEEDLGVVSAHVQDAVFKVAGIHYDARRRQFSLVIN
FT                   RFVWETAEGKRKNFERRRALLLFKCVTAVRSLGFDRADMEAVLDLLAVQFLVKGEGPDG
FT                   TVELVLAGEASIALDVECIEAQLADTGGAWETAFRPRHPEGD"
     MDALKLLALD EEDLGVVSAH VQDAVFKVAG IHYDARRRQF SLVINRFVWE TAEGKRKNFE        60
     RRRALLLFKC VTAVRSLGFD RADMEAVLDL LAVQFLVKGE GPDGTVELVL AGEASIALDV       120
     ECIEAQLADT GGAWETAFRP RHPEGD                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page