(data stored in ACNUC7421 zone)

EMBL: CP001389.PE22

CP001389.PE22        Location/Qualifiers
FT   CDS             20006..20383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00220"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23826"
FT                   /db_xref="GOA:C3MEK3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK3"
FT                   /protein_id="ACP23826.1"
FT                   /translation="MFRASGATFQASQADRKSKKTKGAKVIKSELVQIVAARNPHLYHR
FT                   DVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPF
FT                   FKTGKELRERLNPGMNDRDDD"
     MFRASGATFQ ASQADRKSKK TKGAKVIKSE LVQIVAARNP HLYHRDVENI VNAVLDEITD        60
     ALAAGNRVEL RGFGAFSVKN RPSRSGRNPR TGDSVFVEEK WVPFFKTGKE LRERLNPGMN       120
     DRDDD                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page