(data stored in ACNUC7421 zone)

EMBL: CP001389.PE220

CP001389.PE220       Location/Qualifiers
FT   CDS             256816..257292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24024"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX3"
FT                   /protein_id="ACP24024.1"
FT                   /translation="MRADRHLRLCDVVLDETIGRSTPDVEHERAVAIFDLLEENLFEPA
FT                   GHPGGPYRLNLSLVDSKLVFAISTDGGEAVATHILSLTPFRRIVKDYFLICESYYEAIR
FT                   SATPSQIEAIDMGRRGIHNEGSQTLMDRLSGKIRLDFDTARRLFTLVCVLYWRG"
     MRADRHLRLC DVVLDETIGR STPDVEHERA VAIFDLLEEN LFEPAGHPGG PYRLNLSLVD        60
     SKLVFAISTD GGEAVATHIL SLTPFRRIVK DYFLICESYY EAIRSATPSQ IEAIDMGRRG       120
     IHNEGSQTLM DRLSGKIRLD FDTARRLFTL VCVLYWRG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page